CacheBy
Atlas Antibodies Anti-PPME1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPME1 Antibody

상품 한눈에 보기

인간 PPME1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 정제되었습니다. 높은 종간 서열 일치율(인간-쥐-마우스 99%)을 보입니다. 40% glycerol/PBS buffer에 sodium azide 보존제가 포함되어 있습니다.

카탈로그번호
HPA043900-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043900-100 Anti-PPME1 Antibody, protein phosphatase methylesterase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043900-25 Anti-PPME1 Antibody, protein phosphatase methylesterase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPME1 Antibody

Anti-PPME1 Antibody

Target Information

  • Target Protein: Protein phosphatase methylesterase 1
  • Target Gene: PPME1
  • Alternative Gene Names: PME-1
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human PPME1.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    PPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000017227 (99%)
  • Mouse ENSMUSG00000030718 (99%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.