AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPM1L Antibody
상품 한눈에 보기
Human PPM1L 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 WB(Recombinant Expression) 검증에 적합. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존제 포함.
- 카탈로그번호
- HPA019891-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019891-100 Anti-PPM1L Antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1L 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019891-25 Anti-PPM1L Antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1L 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPM1L Antibody
Anti-PPM1L Antibody
Target Protein: protein phosphatase, Mg²⁺/Mn²⁺ dependent, 1L
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human PPM1L.
Alternative Gene Names
- PP2CE
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase, Mg²⁺/Mn²⁺ dependent, 1L |
| Target Gene | PPM1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000046168 (100%), Mouse ENSMUSG00000027784 (100%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
VLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTF제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.