CacheBy
Atlas Antibodies Anti-CLDN18 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLDN18 Antibody

상품 한눈에 보기

Human CLDN18 단백질을 타깃으로 하는 폴리클로날 Rabbit IgG 항체. IHC Orthogonal 검증을 통해 RNA-seq 데이터와 단백질 발현 비교 가능. PrEST 항원을 이용한 친화 정제. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018446-100 Anti-CLDN18 Antibody, claudin 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018446-25 Anti-CLDN18 Antibody, claudin 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLDN18 Antibody

Anti-CLDN18 Antibody

Target Protein: claudin 18
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human CLDN18.


Alternative Gene Names

  • SFTPJ

Target Information

항목 내용
Target Protein claudin 18
Target Gene CLDN18
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000030386 (80%), Mouse ENSMUSG00000032473 (80%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.