CacheBy
Atlas Antibodies Anti-CLCNKA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLCNKA Antibody

상품 한눈에 보기

인간 CLCNKA 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 PBS 완충액에 보존제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057717-100 Anti-CLCNKA Antibody, chloride channel, voltage-sensitive Ka 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057717-25 Anti-CLCNKA Antibody, chloride channel, voltage-sensitive Ka 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLCNKA Antibody

Anti-CLCNKA Antibody

Target: Chloride channel, voltage-sensitive Ka
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CLCNKA (chloride channel, voltage-sensitive Ka).

Alternative Gene Names: hClC-Ka
Clonality: Polyclonal
Isotype: IgG
Host: Rabbit


  • Immunohistochemistry (IHC)

Target Information

항목 내용
Target Protein Chloride channel, voltage-sensitive Ka
Target Gene CLCNKA
Alternative Gene Name hClC-Ka
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000009897 (74%), Mouse ENSMUSG00000006216 (74%)

Buffer Composition


Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.