
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CLCNKA Antibody
상품 한눈에 보기
인간 CLCNKA 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 PBS 완충액에 보존제가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057717-100 Anti-CLCNKA Antibody, chloride channel, voltage-sensitive Ka 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057717-25 Anti-CLCNKA Antibody, chloride channel, voltage-sensitive Ka 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CLCNKA Antibody
Anti-CLCNKA Antibody
Target: Chloride channel, voltage-sensitive Ka
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human CLCNKA (chloride channel, voltage-sensitive Ka).
Alternative Gene Names: hClC-Ka
Clonality: Polyclonal
Isotype: IgG
Host: Rabbit
Recommended Applications
- Immunohistochemistry (IHC)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chloride channel, voltage-sensitive Ka |
| Target Gene | CLCNKA |
| Alternative Gene Name | hClC-Ka |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000009897 (74%), Mouse ENSMUSG00000006216 (74%) |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide as preservative
- Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



