
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CLCN4 Antibody
상품 한눈에 보기
인간 CLCN4 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 분석에 적합하며 RNA-seq 데이터와의 정합 검증 완료. 고순도 친화정제 제품으로 다양한 종 간 교차 반응성 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA063637-100 Anti-CLCN4 Antibody, chloride channel, voltage-sensitive 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063637-25 Anti-CLCN4 Antibody, chloride channel, voltage-sensitive 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CLCN4 Antibody
Anti-CLCN4 Antibody
Target: chloride channel, voltage-sensitive 4 (CLCN4)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human CLCN4.
Alternative Gene Names
ClC-4, CLC4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chloride channel, voltage-sensitive 4 |
| Target Gene | CLCN4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치도 |
|---|---|---|
| Rat | ENSRNOG00000003533 | 100% |
| Mouse | ENSMUSG00000000605 | 98% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



