CacheBy
Atlas Antibodies Anti-CLCN4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLCN4 Antibody

상품 한눈에 보기

인간 CLCN4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 확인함. 고순도 Affinity 정제 방식으로 제조되었으며, RNA-seq 데이터 비교를 통한 신뢰성 높은 발현 분석에 적합. Human, Rat, Mouse 반응성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031313-100 Anti-CLCN4 Antibody, chloride channel, voltage-sensitive 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031313-25 Anti-CLCN4 Antibody, chloride channel, voltage-sensitive 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLCN4 Antibody

Anti-CLCN4 Antibody

Target: Chloride channel, voltage-sensitive 4
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CLCN4


Alternative Gene Names

ClC-4, CLC4

Open Datasheet


Target Information

항목 내용
Target Protein Chloride channel, voltage-sensitive 4
Target Gene CLCN4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000003533 (100%), Mouse ENSMUSG00000000605 (98%)

Antigen Sequence:
VVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.