CacheBy
Atlas Antibodies Anti-CLCA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLCA1 Antibody

상품 한눈에 보기

인간 CLCA1 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 단백질 발현 확인에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052787-100 Anti-CLCA1 Antibody, chloride channel accessory 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052787-25 Anti-CLCA1 Antibody, chloride channel accessory 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLCA1 Antibody

Anti-CLCA1 Antibody

Target: Chloride channel accessory 1 (CLCA1)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human CLCA1


Alternative Gene Names

CaCC, CLCRG1

Open Datasheet


Target Information

항목 내용
Target Protein Chloride channel accessory 1
Target Gene CLCA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VGMVTFDSAAHVQSELIQINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVIRKKYPTDGSEIVLLTD

Verified Species Reactivity

Human


Interspecies Information

Ortholog ID 항원 서열 동일도
Mouse ENSMUSG00000028255 81%
Rat ENSRNOG00000060831 80%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.