CacheBy
Atlas Antibodies Anti-CLASRP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLASRP Antibody

상품 한눈에 보기

Human CLASRP 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 반응성과 안정적인 PBS/glycerol buffer로 제공됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062455-100 Anti-CLASRP Antibody, CLK4-associating serine/arginine rich protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062455-25 Anti-CLASRP Antibody, CLK4-associating serine/arginine rich protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLASRP Antibody

Anti-CLASRP Antibody

Target: CLK4-associating serine/arginine rich protein
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human CLASRP


Alternative Gene Names

  • CLASP
  • SFRS16
  • SWAP2

Open Datasheet


Target Information

항목 내용
Target Protein CLK4-associating serine/arginine rich protein
Target Gene CLASRP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000061028 (100%), Rat ENSRNOG00000046000 (100%)

Antigen Sequence:
NSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLRKDKE


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.