
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CIITA Antibody
상품 한눈에 보기
인간 CIITA 단백질을 인식하는 폴리클로날 항체로, 클래스 II MHC 전사활성화인자 연구에 적합합니다. 토끼 유래 IgG 형태이며, 고순도 친화 정제 방식으로 제조되었습니다. 인체 반응성이 검증되어 면역세포 활성 연구에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA054757-100 Anti-CIITA Antibody, class II major histocompatibility complex transactivator 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054757-25 Anti-CIITA Antibody, class II major histocompatibility complex transactivator 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CIITA Antibody
Anti-CIITA Antibody
Target: Class II major histocompatibility complex transactivator (CIITA)
Recommended Applications
ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human CIITA.
Alternative Gene Names
C2TA, MHC2TA, NLRA
Target Information
- Target Protein: Class II major histocompatibility complex transactivator
- Target Gene: CIITA
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSMPEPALT
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000022504 | 68% |
| Rat | ENSRNOG00000002659 | 64% |
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



