CacheBy
Atlas Antibodies Anti-CIDEB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CIDEB Antibody

상품 한눈에 보기

Human CIDEB 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. Human 반응성 검증 완료. 사용 전 부드럽게 혼합 권장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001272-100 Anti-CIDEB Antibody, cell death-inducing DFFA-like effector b 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001272-25 Anti-CIDEB Antibody, cell death-inducing DFFA-like effector b 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CIDEB Antibody

Anti-CIDEB Antibody

Target: cell death-inducing DFFA-like effector b (CIDEB)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human CIDEB
Open Datasheet


Target Information

항목 내용
Target Protein cell death-inducing DFFA-like effector b
Target Gene CIDEB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000022219 (83%), Rat ENSRNOG00000020377 (69%)

Antigen Sequence

MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGV


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.