CacheBy
Atlas Antibodies Anti-CHRM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHRM1 Antibody

상품 한눈에 보기

CHRM1 단백질을 인식하는 사람 유래 폴리클로날 항체로, 토끼에서 생산됨. IHC 정량 검증(Orthogonal validation)을 통해 RNA-seq 데이터와 비교 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 다양한 조직의 단백질 발현 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014101-100 Anti-CHRM1 Antibody, cholinergic receptor, muscarinic 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014101-25 Anti-CHRM1 Antibody, cholinergic receptor, muscarinic 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHRM1 Antibody

Anti-CHRM1 Antibody

Target: cholinergic receptor, muscarinic 1 (CHRM1)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human CHRM1.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cholinergic receptor, muscarinic 1
Target Gene CHRM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000032773 (98%), Rat ENSRNOG00000018385 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.