
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CHORDC1 Antibody
상품 한눈에 보기
인체 CHORDC1 단백질에 특이적인 폴리클로날 항체로, IHC·WB·ICC 등 다양한 응용에 적합. Rabbit에서 생산되었으며, 정제된 PrEST 항원 기반으로 높은 특이성과 재현성을 제공. Human, Mouse, Rat 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041040-100 Anti-CHORDC1 Antibody, cysteine and histidine-rich domain (CHORD) containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041040-25 Anti-CHORDC1 Antibody, cysteine and histidine-rich domain (CHORD) containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CHORDC1 Antibody
Anti-CHORDC1 Antibody
Cysteine and histidine-rich domain (CHORD) containing 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Orthogonal validation)
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human CHORDC1
Alternative Gene Names
- CHP1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cysteine and histidine-rich domain (CHORD) containing 1 |
| Target Gene | CHORDC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000026643 (99%), Mouse ENSMUSG00000001774 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



