CacheBy
Atlas Antibodies Anti-CHORDC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHORDC1 Antibody

상품 한눈에 보기

인체 CHORDC1 단백질에 특이적인 폴리클로날 항체로, IHC·WB·ICC 등 다양한 응용에 적합. Rabbit에서 생산되었으며, 정제된 PrEST 항원 기반으로 높은 특이성과 재현성을 제공. Human, Mouse, Rat 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041040-100 Anti-CHORDC1 Antibody, cysteine and histidine-rich domain (CHORD) containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041040-25 Anti-CHORDC1 Antibody, cysteine and histidine-rich domain (CHORD) containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHORDC1 Antibody

Anti-CHORDC1 Antibody

Cysteine and histidine-rich domain (CHORD) containing 1


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)
    • Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human CHORDC1


Alternative Gene Names

  • CHP1

Open Datasheet


Target Information

항목 내용
Target Protein cysteine and histidine-rich domain (CHORD) containing 1
Target Gene CHORDC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000026643 (99%), Mouse ENSMUSG00000001774 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.