
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CHML Antibody
상품 한눈에 보기
휴먼 CHML 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원으로 친화 정제되었습니다. 40% 글리세롤/PBS 완충액에 보존되어 장기 보관이 용이합니다. 독립적 검증을 통해 신뢰성 높은 결과를 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029628-100 Anti-CHML Antibody, choroideremia-like (Rab escort protein 2) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029628-25 Anti-CHML Antibody, choroideremia-like (Rab escort protein 2) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CHML Antibody
Anti-CHML Antibody
Target: choroideremia-like (Rab escort protein 2)
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB) – Independent antibody validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CHML.
Alternative Gene Names
- REP-2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | choroideremia-like (Rab escort protein 2) |
| Target Gene | CHML |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVS |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000078185 (70%), Rat ENSRNOG00000000161 (38%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



