CacheBy
Atlas Antibodies Anti-CHID1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHID1 Antibody

상품 한눈에 보기

인간 CHID1 단백질을 인식하는 폴리클로날 항체입니다. Rabbit에서 생산되었으며, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, Rat 및 Mouse에서도 높은 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039374-100 Anti-CHID1 Antibody, chitinase domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039374-25 Anti-CHID1 Antibody, chitinase domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHID1 Antibody

Anti-CHID1 Antibody

chitinase domain containing 1

  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human CHID1.

Alternative Gene Names

FLJ42707, MGC3234

Open Datasheet

Target Information

항목 내용
Target Protein chitinase domain containing 1
Target Gene CHID1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000050181 (90%)
  • Mouse ENSMUSG00000025512 (87%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.