CacheBy
Atlas Antibodies Anti-CHDH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHDH Antibody

상품 한눈에 보기

인간 CHDH 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터 기반 정교한 Orthogonal validation 수행. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058130-100 Anti-CHDH Antibody, choline dehydrogenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058130-25 Anti-CHDH Antibody, choline dehydrogenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHDH Antibody

Anti-CHDH Antibody

Target: choline dehydrogenase (CHDH)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against human CHDH (choline dehydrogenase).
Validated for multiple applications with enhanced validation methods.

Open Datasheet (PDF)


Product Specifications

항목 내용
Target Protein choline dehydrogenase
Target Gene CHDH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GWMDMTIHEGKRWSAACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPV
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000015859 (86%), Mouse ENSMUSG00000015970 (83%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.