
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CHD4 Antibody
상품 한눈에 보기
Human CHD4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종 간 보존성을 보입니다. PBS와 글리세롤 완충액에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA012008-100 Anti-CHD4 Antibody, chromodomain helicase DNA binding protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012008-25 Anti-CHD4 Antibody, chromodomain helicase DNA binding protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CHD4 Antibody
Anti-CHD4 Antibody
Target: Chromodomain helicase DNA binding protein 4 (CHD4)
Type: Polyclonal Antibody against Human CHD4
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against human CHD4 (chromodomain helicase DNA binding protein 4). It is affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
- Mi-2b
- Mi2-BETA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chromodomain helicase DNA binding protein 4 |
| Target Gene | CHD4 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | DALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKELGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEDDDDDDSKEP |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (97%), Rat (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | PBS (pH 7.2) with 40% glycerol |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



