CacheBy
Atlas Antibodies Anti-CHD4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHD4 Antibody

상품 한눈에 보기

Human CHD4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종 간 보존성을 보입니다. PBS와 글리세롤 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012008-100 Anti-CHD4 Antibody, chromodomain helicase DNA binding protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012008-25 Anti-CHD4 Antibody, chromodomain helicase DNA binding protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHD4 Antibody

Anti-CHD4 Antibody

Target: Chromodomain helicase DNA binding protein 4 (CHD4)
Type: Polyclonal Antibody against Human CHD4


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against human CHD4 (chromodomain helicase DNA binding protein 4). It is affinity purified using the PrEST antigen as the affinity ligand.


Alternative Gene Names

  • Mi-2b
  • Mi2-BETA

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chromodomain helicase DNA binding protein 4
Target Gene CHD4
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence DALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKELGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEDDDDDDSKEP
Verified Species Reactivity Human
Interspecies Homology Mouse (97%), Rat (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer PBS (pH 7.2) with 40% glycerol
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.