
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CHD1L Antibody
상품 한눈에 보기
인간 CHD1L 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, 유전적 및 독립 항체 검증을 통해 신뢰성이 입증되었습니다. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 기반 완충액에 보존됩니다.
- 카탈로그번호
- HPA027789-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027789-100 Anti-CHD1L Antibody, chromodomain helicase DNA binding protein 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027789-25 Anti-CHD1L Antibody, chromodomain helicase DNA binding protein 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CHD1L Antibody
Anti-CHD1L Antibody
Target: chromodomain helicase DNA binding protein 1-like (CHD1L)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human CHD1L.
Alternative Gene Names
- ALC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromodomain helicase DNA binding protein 1-like |
| Target Gene | CHD1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000028089 (82%), Rat ENSRNOG00000017669 (80%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



