CacheBy
Atlas Antibodies Anti-CHD1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHD1L Antibody

상품 한눈에 보기

인간 CHD1L 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, 유전적 및 독립 항체 검증을 통해 신뢰성이 입증되었습니다. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 기반 완충액에 보존됩니다.

카탈로그번호
HPA027789-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027789-100 Anti-CHD1L Antibody, chromodomain helicase DNA binding protein 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027789-25 Anti-CHD1L Antibody, chromodomain helicase DNA binding protein 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHD1L Antibody

Anti-CHD1L Antibody

Target: chromodomain helicase DNA binding protein 1-like (CHD1L)
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human CHD1L.


Alternative Gene Names

  • ALC1

Target Information

항목 내용
Target Protein chromodomain helicase DNA binding protein 1-like
Target Gene CHD1L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPR
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000028089 (82%), Rat ENSRNOG00000017669 (80%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.