CacheBy
Atlas Antibodies Anti-CGNL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CGNL1 Antibody

상품 한눈에 보기

Human CGNL1 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, Rabbit에서 생산되고 PrEST 항원으로 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056911-100 Anti-CGNL1 Antibody, cingulin-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056911-25 Anti-CGNL1 Antibody, cingulin-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CGNL1 Antibody

Anti-CGNL1 Antibody

Target Protein: cingulin-like 1
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CGNL1

Alternative Gene Names

  • FLJ14957
  • JACOP
  • KIAA1749
  • Paracingulin

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

NEKVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIAK

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000032232 91%
Rat ENSRNOG00000054080 89%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.