CacheBy
Atlas Antibodies Anti-CGN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CGN Antibody

상품 한눈에 보기

Human CGN 단백질을 표적으로 하는 폴리클로날 토끼 항체로, IHC와 WB에서 RNA-seq 데이터 기반 정합 검증 수행. Affinity purification으로 높은 특이성과 재현성 확보. 40% glycerol PBS buffer 포함, 인체 시료 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027586-100 Anti-CGN Antibody, cingulin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027586-25 Anti-CGN Antibody, cingulin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CGN Antibody

Anti-CGN Antibody

Target Protein: cingulin
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal Antibody against Human CGN


Alternative Gene Names

  • KIAA1319

Open Datasheet


Specifications

항목 내용
Target Protein cingulin
Target Gene CGN
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000068876 (87%), Rat ENSRNOG00000020952 (83%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Antigen Sequence

PPGSVDHMKATIYGILREGSSESETSVRRKVSLVLEKMQPLVMVSSGSTKAVAGQGELTRKVEELQRKLDEEVKKRQKLEPSQVGLERQLEEKTEECSRLQELLER

Safety Information

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.