CacheBy
Atlas Antibodies Anti-CGB3 Antibody
원본

Atlas Antibodies Anti-CGB3 Antibody

상품 한눈에 보기

인간 CGB3 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적으로 반응하며, 40% 글리세롤 PBS 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038934-100 Anti-CGB3 Antibody, chorionic gonadotropin beta subunit 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038934-25 Anti-CGB3 Antibody, chorionic gonadotropin beta subunit 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CGB3 Antibody

Anti-CGB3 Antibody

Target Information

  • Target Protein: Chorionic gonadotropin beta subunit 3
  • Target Gene: CGB3
  • Alternative Gene Names: CGB
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CGB3.

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    PTMTRVLQGVLPALPQVVCNYRDVRFESIRLP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000100916 59%
Rat ENSRNOG00000047040 59%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.