AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CFP Antibody
상품 한눈에 보기
Human CFP 단백질을 인식하는 토끼 폴리클로날 항체로, complement factor properdin 연구용에 적합. Recombinant PrEST 항원으로 정제됨. 인체 반응성 검증 완료. ICC 등 다양한 응용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA072644-100 Anti-CFP Antibody, complement factor properdin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072644-25 Anti-CFP Antibody, complement factor properdin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CFP Antibody
Anti-CFP Antibody
Target Information
- Target Protein: Complement Factor Properdin
- Target Gene: CFP
- Alternative Gene Names: PFC
Product Description
Polyclonal antibody against human CFP.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
LCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCS
Species Reactivity
- Verified Reactivity: Human
- Interspecies Identity:
- Rat (ENSRNOG00000025811): 75%
- Mouse (ENSMUSG00000001128): 75%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Recommended Applications
Immunocytochemistry (ICC)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.