CacheBy
Atlas Antibodies Anti-CFH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CFH Antibody

상품 한눈에 보기

Human CFH를 타깃으로 하는 polyclonal rabbit IgG 항체로, IHC 및 Western Blot에 적합합니다. PrEST 항원으로 정제되었으며, 40% glycerol과 PBS buffer에 보존됩니다. Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053326-100 Anti-CFH Antibody, complement factor H 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053326-25 Anti-CFH Antibody, complement factor H 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CFH Antibody

Anti-CFH Antibody

Target Information

  • Target Protein: Complement Factor H
  • Target Gene: CFH
  • Alternative Gene Names: ARMD4, ARMS1, FHL1, HF, HF1, HF2, HUS
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human CFH.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000026365 66%
Rat ENSRNOG00000030715 66%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.