CacheBy
Atlas Antibodies Anti-CFB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CFB Antibody

상품 한눈에 보기

인체 CFB 단백질을 타깃으로 한 폴리클로날 항체입니다. 토끼에서 생산된 IgG 항체로, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증되었으며, 보존제로 sodium azide를 포함합니다. 다양한 응용 분야에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000951-100 Anti-CFB Antibody, complement factor B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000951-25 Anti-CFB Antibody, complement factor B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CFB Antibody

Anti-CFB Antibody

Target Information

  • Target Protein: Complement factor B
  • Target Gene: CFB
  • Alternative Gene Names: BF, BFD, H2-Bf

Product Description

Polyclonal antibody against human complement factor B (CFB).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000092511): 82%
  • Rat (ENSRNOG00000000419): 79%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Applications ICC and other immunoassays (optimal conditions to be determined by user)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)
Material Safety Data Sheet (Sodium Azide)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.