CacheBy
Atlas Antibodies Anti-CFAP46 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CFAP46 Antibody

상품 한눈에 보기

인간 CFAP46 단백질을 인식하는 폴리클로날 항체로, 섬모 및 편모 관련 단백질 연구에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증되었으며, Rat 및 Mouse와 높은 상동성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038034-100 Anti-CFAP46 Antibody, cilia and flagella associated protein 46 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038034-25 Anti-CFAP46 Antibody, cilia and flagella associated protein 46 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CFAP46 Antibody

Anti-CFAP46 Antibody

Target: Cilia and flagella associated protein 46 (CFAP46)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human CFAP46.


Alternative Gene Names

bA288G11.4, bA288G11.5, bB137A17.2, bB137A17.3, C10orf123, C10orf124, C10orf92, C10orf93, DKFZp434A1721, FLJ25954, TTC40

Open Datasheet


Target Information

항목 내용
Target Protein Cilia and flagella associated protein 46
Target Gene CFAP46

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LAPDAFQIVLDSENEAKVSTGKNRGRFTYLCAKAWHHTVSVDKAAGHLRRLGNENDKERIQIWAELAKVARKQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000027374 (84%)
  • Mouse ENSMUSG00000049571 (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.