CacheBy
Atlas Antibodies Anti-CFAP20 Antibody
원본

Atlas Antibodies Anti-CFAP20 Antibody

상품 한눈에 보기

Human CFAP20 단백질을 인식하는 토끼 폴리클로날 항체로, 섬모 및 편모 관련 단백질 연구에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. ICC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018195-100 Anti-CFAP20 Antibody, cilia and flagella associated protein 20 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018195-25 Anti-CFAP20 Antibody, cilia and flagella associated protein 20 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CFAP20 Antibody

Anti-CFAP20 Antibody

Target: cilia and flagella associated protein 20 (CFAP20)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CFAP20, suitable for research on cilia and flagella associated proteins.

Alternative Gene Names

C16orf80, fSAP23, GTL3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cilia and flagella associated protein 20
Target Gene CFAP20
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031796 (99%), Rat ENSRNOG00000042179 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer and Storage

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

  • ICC (Immunocytochemistry)

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.