
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CERCAM Antibody
상품 한눈에 보기
Human CERCAM 단백질을 인식하는 토끼 폴리클로날 항체로, 뇌내피세포 부착분자 연구에 적합. IHC 등 다양한 응용 가능. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021657-100 Anti-CERCAM Antibody, cerebral endothelial cell adhesion molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021657-25 Anti-CERCAM Antibody, cerebral endothelial cell adhesion molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CERCAM Antibody
Anti-CERCAM Antibody
Cerebral endothelial cell adhesion molecule
Recommended Applications
면역조직화학(IHC) 등 다양한 생물학적 연구 응용에 사용 가능.
Product Description
Polyclonal Antibody against Human CERCAM
Alternative Gene Names
CEECAM1, CerCAM, GLT25D3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cerebral endothelial cell adhesion molecule |
| Target Gene | CERCAM |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDG |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000026604 (84%), Mouse ENSMUSG00000039787 (81%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



