
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CEP76 Antibody
상품 한눈에 보기
Human CEP76 단백질을 인식하는 토끼 폴리클로날 항체로, 세포 중심체 단백질 연구에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 사용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039395-100 Anti-CEP76 Antibody, centrosomal protein 76kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039395-25 Anti-CEP76 Antibody, centrosomal protein 76kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CEP76 Antibody
Anti-CEP76 Antibody
Target Information
- Target Protein: Centrosomal protein 76 kDa
- Target Gene: CEP76
- Alternative Gene Names: C18orf9, FLJ12542, HsT1705
Product Description
Polyclonal antibody against human CEP76. This antibody recognizes centrosomal protein 76 kDa and is suitable for various research applications, including immunohistochemistry (IHC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000073542 | 97% |
| Rat | ENSRNOG00000021918 | 97% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
Immunohistochemistry (IHC)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



