CacheBy
Atlas Antibodies Anti-CEP76 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CEP76 Antibody

상품 한눈에 보기

Human CEP76 단백질을 인식하는 토끼 폴리클로날 항체로, 세포 중심체 단백질 연구에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039395-100 Anti-CEP76 Antibody, centrosomal protein 76kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039395-25 Anti-CEP76 Antibody, centrosomal protein 76kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CEP76 Antibody

Anti-CEP76 Antibody

Target Information

  • Target Protein: Centrosomal protein 76 kDa
  • Target Gene: CEP76
  • Alternative Gene Names: C18orf9, FLJ12542, HsT1705

Product Description

Polyclonal antibody against human CEP76. This antibody recognizes centrosomal protein 76 kDa and is suitable for various research applications, including immunohistochemistry (IHC).

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000073542 97%
Rat ENSRNOG00000021918 97%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Immunohistochemistry (IHC)

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.