CacheBy
Atlas Antibodies Anti-CEP57L1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CEP57L1 Antibody

상품 한눈에 보기

휴먼 CEP57L1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응성이 검증되었으며, 사용 전 부드럽게 혼합하여 사용을 권장합니다.

카탈로그번호
HPA040378-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040378-100 Anti-CEP57L1 Antibody, centrosomal protein 57kDa-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040378-25 Anti-CEP57L1 Antibody, centrosomal protein 57kDa-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CEP57L1 Antibody

Anti-CEP57L1 Antibody

Target: Centrosomal protein 57kDa-like 1 (CEP57L1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CEP57L1.


Alternative Gene Names

bA487F23.2, C6orf182, MGC21731

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Centrosomal protein 57kDa-like 1
Target Gene CEP57L1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRDPHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQE
Verified Species Reactivity Human
Interspecies Homology Mouse: 44% (ENSMUSG00000019813), Rat: 43% (ENSRNOG00000000303)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Information

구성 상세 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.