CacheBy
Atlas Antibodies Anti-CEP290 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CEP290 Antibody

상품 한눈에 보기

인간 CEP290 단백질을 인식하는 토끼 폴리클로날 항체. 세포 중심 단백질 연구용으로 적합. PrEST 항원으로 친화 정제됨. 인체 반응성 검증 완료. 다양한 응용 분야에 사용할 수 있음.

카탈로그번호
HPA043918-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043918-100 Anti-CEP290 Antibody, centrosomal protein 290kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043918-25 Anti-CEP290 Antibody, centrosomal protein 290kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CEP290 Antibody

Anti-CEP290 Antibody

Target: Centrosomal protein 290 kDa
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CEP290.


Alternative Gene Names

3H11Ag, BBS14, CT87, FLJ13615, JBTS5, KIAA0373, LCA10, MKS4, NPHP6, POC3, rd16, SLSN6

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Centrosomal protein 290 kDa
Target Gene CEP290
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (92%), Rat (91%)

Antigen Sequence:
QVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAELT


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


  • Immunohistochemistry (IHC)
  • Additional applications may require optimization by the user.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.