CacheBy
Atlas Antibodies Anti-CEP164 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CEP164 Antibody

상품 한눈에 보기

인간 CEP164 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 및 면역세포화학(ICC)에 적합합니다. Rabbit에서 생산되었으며 IgG 아이소타입입니다. PrEST 항원을 이용해 친화 정제되었고, 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061504-100 Anti-CEP164 Antibody, centrosomal protein 164 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061504-25 Anti-CEP164 Antibody, centrosomal protein 164 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CEP164 Antibody

Anti-CEP164 Antibody

Target Protein: Centrosomal protein 164kDa
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CEP164.


Alternative Gene Names

  • KIAA1052
  • NPHP15

Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000043987 (54%)
  • Rat ENSRNOG00000029826 (51%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand
Target Gene CEP164
Target Protein Centrosomal protein 164kDa

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.