
원본
Atlas Antibodies Anti-CEP120 Antibody
상품 한눈에 보기
Human CEP120 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성(인간, 생쥐, 랫드)을 보입니다. 40% 글리세롤/PBS 버퍼에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028823-100 Anti-CEP120 Antibody, centrosomal protein 120kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028823-25 Anti-CEP120 Antibody, centrosomal protein 120kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CEP120 Antibody
Anti-CEP120 Antibody
Target: Centrosomal protein 120kDa (CEP120)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human centrosomal protein 120kDa (CEP120).
Alternative Gene Names
CCDC100, FLJ36090
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
EEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQSLGSTEIPLTGLLKKGSTEINQHPVTVEGAF
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000048799 | 96% |
| Rat | ENSRNOG00000017035 | 95% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



