CacheBy
Atlas Antibodies Anti-CENPW Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CENPW Antibody

상품 한눈에 보기

Human CENPW 단백질을 인식하는 Rabbit Polyclonal 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Rat, Mouse에서도 부분적 교차 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067285-100 Anti-CENPW Antibody, centromere protein W 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067285-25 Anti-CENPW Antibody, centromere protein W 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CENPW Antibody

Anti-CENPW Antibody

Target Information

  • Target Protein: Centromere protein W
  • Target Gene: CENPW
  • Alternative Gene Names: C6orf173, CUG2

Product Description

Polyclonal antibody against human CENPW.

  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEK

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Information:
    • Rat (ENSRNOG00000042944) — 62% identity
    • Mouse (ENSMUSG00000075266) — 59% identity

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.