
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CENPW Antibody
상품 한눈에 보기
Human CENPW 단백질을 인식하는 Rabbit Polyclonal 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Rat, Mouse에서도 부분적 교차 반응성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA067285-100 Anti-CENPW Antibody, centromere protein W 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067285-25 Anti-CENPW Antibody, centromere protein W 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CENPW Antibody
Anti-CENPW Antibody
Target Information
- Target Protein: Centromere protein W
- Target Gene: CENPW
- Alternative Gene Names: C6orf173, CUG2
Product Description
Polyclonal antibody against human CENPW.
Recommended Applications
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence: MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEK
Species Reactivity
- Verified Reactivity: Human
- Interspecies Information:
- Rat (ENSRNOG00000042944) — 62% identity
- Mouse (ENSMUSG00000075266) — 59% identity
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



