Atlas Antibodies Anti-CENPL Antibody

상품 한눈에 보기

Human CENPL 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB에 적합하며, PrEST 항원으로 친화 정제됨. Human에 반응하며, 40% glycerol/PBS buffer로 안정화됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044520-100 Anti-CENPL Antibody, centromere protein L 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044520-25 Anti-CENPL Antibody, centromere protein L 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Centromere protein L (CENPL)
Supplier: Atlas Antibodies

Polyclonal antibody against Human CENPL.

C1orf155, dJ383J4.3, FLJ31044

항목	내용
Target Protein	Centromere protein L
Target Gene	CENPL
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000038789 (68%), Mouse ENSMUSG00000026708 (65%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS	Material Safety Data Sheet

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVDPQKVAFLLHKQWTLYSLTPLYKF

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.