CacheBy
Atlas Antibodies Anti-CENPJ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CENPJ Antibody

상품 한눈에 보기

Human CENPJ 단백질을 인식하는 Rabbit Polyclonal 항체로, centromere protein J 검출에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. ICC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060426-100 Anti-CENPJ Antibody, centromere protein J 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060426-25 Anti-CENPJ Antibody, centromere protein J 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CENPJ Antibody

Anti-CENPJ Antibody

Target: Centromere protein J
Supplier: Atlas Antibodies

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CENPJ.

Alternative Gene Names

BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4

Open Datasheet

Target Information

항목 내용
Target Protein Centromere protein J
Target Gene CENPJ
Verified Species Reactivity Human
Interspecies Identity Mouse (64%), Rat (60%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DRERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESIMESIKHKVSEPSRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTYGTPQTCYPNNEIGILDKTIKRKIAPVK

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.