CacheBy
Atlas Antibodies Anti-CELF6 Antibody
원본

Atlas Antibodies Anti-CELF6 Antibody

상품 한눈에 보기

Human CELF6 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며 PrEST 항원으로 특이적 정제됨. Human에 반응성이 검증되었으며 Mouse와 Rat에서도 높은 유사성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046985-100 Anti-CELF6 Antibody, CUGBP, Elav-like family member 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046985-25 Anti-CELF6 Antibody, CUGBP, Elav-like family member 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CELF6 Antibody

Anti-CELF6 Antibody

CUGBP, Elav-like family member 6

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CELF6.

Alternative Gene Names

  • BRUNOL6

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein CUGBP, Elav-like family member 6
Target Gene CELF6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000032297 (86%), Rat ENSRNOG00000052224 (86%)

Antigen Sequence:

TLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.