CacheBy
Atlas Antibodies Anti-CEBPE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CEBPE Antibody

상품 한눈에 보기

인간 CEBPE 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit에서 생산되었으며 PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Orthogonal validation으로 RNA-seq 데이터 기반 검증 완료.

카탈로그번호
HPA002928-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002928-100 Anti-CEBPE Antibody, CCAAT/enhancer binding protein (C/EBP), epsilon 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002928-25 Anti-CEBPE Antibody, CCAAT/enhancer binding protein (C/EBP), epsilon 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CEBPE Antibody

Anti-CEBPE Antibody

Target Protein: CCAAT/enhancer binding protein (C/EBP), epsilon
Supplier: Atlas Antibodies

  • IHC (Orthogonal validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Orthogonal validation:
Protein expression validated using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human CEBPE.

Alternative Gene Names

  • CRP1

Open Datasheet

Specifications

항목 내용
Target Protein CCAAT/enhancer binding protein (C/EBP), epsilon
Target Gene CEBPE
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000052435 (94%), Rat ENSRNOG00000014282 (94%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.