CacheBy
Atlas Antibodies Anti-CDYL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDYL2 Antibody

상품 한눈에 보기

휴먼 CDYL2 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가짐. 글리세롤 기반 완충용액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041016-100 Anti-CDYL2 Antibody, chromodomain protein, Y-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041016-25 Anti-CDYL2 Antibody, chromodomain protein, Y-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDYL2 Antibody

Anti-CDYL2 Antibody

Target Protein: Chromodomain protein, Y-like 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human CDYL2.


Alternative Gene Names

  • FLJ38866

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chromodomain protein, Y-like 2
Target Gene CDYL2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHMSKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPL

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000031758 84%
Rat ENSRNOG00000042888 82%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.