CacheBy
Atlas Antibodies Anti-CDKN2AIP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDKN2AIP Antibody

상품 한눈에 보기

Human CDKN2AIP 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원으로 정제되었습니다. 인간에 대한 반응성이 검증되었고, 높은 종간 서열 동일성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062142-100 Anti-CDKN2AIP Antibody, CDKN2A interacting protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062142-25 Anti-CDKN2AIP Antibody, CDKN2A interacting protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDKN2AIP Antibody

Anti-CDKN2AIP Antibody

CDKN2A interacting protein

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human CDKN2AIP

Alternative Gene Names

  • CARF
  • FLJ20036

Open Datasheet

Target Information

항목 내용
Target Protein CDKN2A interacting protein
Target Gene CDKN2AIP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000038069 (99%), Rat ENSRNOG00000022736 (99%)

Antigen Sequence:
ELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRGSEIEDLVLLDEESRPVNLPPAL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.