Atlas Antibodies Anti-CDK20 Antibody

상품 한눈에 보기

Human CDK20 단백질을 인식하는 고품질 폴리클로날 항체. Rabbit 유래 IgG로 제작되었으며, IHC 및 WB 검증 완료. Recombinant expression 및 orthogonal validation을 통해 정확한 단백질 발현 확인 가능. CCRK, p42 대체 유전자명 포함.

카탈로그번호: HPA027379-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027379-100 Anti-CDK20 Antibody, cyclin-dependent kinase 20 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027379-25 Anti-CDK20 Antibody, cyclin-dependent kinase 20 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CDK20 Antibody

Anti-CDK20 Antibody

Target: cyclin-dependent kinase 20 (CDK20)
Type: Polyclonal Antibody against Human CDK20
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody targeting Human CDK20.

Alternative Gene Names: CCRK, p42
Open Datasheet

Target Information

항목	내용
Target Protein	cyclin-dependent kinase 20
Target Gene	CDK20
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASK

Species Reactivity

종	유전자 ID	항원 서열 일치도
Human	—	—
Mouse	ENSMUSG00000021483	87%
Rat	ENSRNOG00000017991	86%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand