
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CDK20 Antibody
상품 한눈에 보기
Human CDK20 단백질을 인식하는 고품질 폴리클로날 항체. Rabbit 유래 IgG로 제작되었으며, IHC 및 WB 검증 완료. Recombinant expression 및 orthogonal validation을 통해 정확한 단백질 발현 확인 가능. CCRK, p42 대체 유전자명 포함.
- 카탈로그번호
- HPA027379-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027379-100 Anti-CDK20 Antibody, cyclin-dependent kinase 20 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027379-25 Anti-CDK20 Antibody, cyclin-dependent kinase 20 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CDK20 Antibody
Anti-CDK20 Antibody
Target: cyclin-dependent kinase 20 (CDK20)
Type: Polyclonal Antibody against Human CDK20
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody targeting Human CDK20.
Alternative Gene Names: CCRK, p42
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cyclin-dependent kinase 20 |
| Target Gene | CDK20 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASK |
Species Reactivity
| 종 | 유전자 ID | 항원 서열 일치도 |
|---|---|---|
| Human | — | — |
| Mouse | ENSMUSG00000021483 | 87% |
| Rat | ENSRNOG00000017991 | 86% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



