
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CDK1 Antibody
상품 한눈에 보기
Human CDK1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증 완료. PrEST 항원으로 특이적 정제된 고품질 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA003387-100 Anti-CDK1 Antibody, cyclin-dependent kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003387-25 Anti-CDK1 Antibody, cyclin-dependent kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CDK1 Antibody
Anti-CDK1 Antibody
Target: cyclin-dependent kinase 1 (CDK1)
Type: Polyclonal Antibody against Human CDK1
Recommended Applications
- IHC (Orthogonal validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation:
단백질 발현을 RNA-seq 데이터와 비교하여 고발현 및 저발현 조직에서 검증함.
Product Description
Polyclonal antibody against human CDK1.
Alternative Gene Names
CDC2, CDC28A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cyclin-dependent kinase 1 |
| Target Gene | CDK1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000000632 (98%)
- Mouse ENSMUSG00000019942 (98%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



