CacheBy
Atlas Antibodies Anti-CDK10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDK10 Antibody

상품 한눈에 보기

인간 CDK10 단백질에 특이적인 폴리클로날 항체. IHC 등 다양한 실험에 활용 가능. 친화성 정제된 고순도 항체로 높은 반응 특이성 제공. 토끼 유래 IgG 형식으로 안정적인 보존용 버퍼 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059634-100 Anti-CDK10 Antibody, cyclin-dependent kinase 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059634-25 Anti-CDK10 Antibody, cyclin-dependent kinase 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDK10 Antibody

Anti-CDK10 Antibody

Target Information

  • Target Protein: Cyclin dependent kinase 10
  • Target Gene: CDK10
  • Alternative Gene Names: PISSLRE

Product Description

Polyclonal antibody against human CDK10.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000033862): 99%
  • Rat (ENSRNOG00000016088): 98%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

IHC (Immunohistochemistry)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.