CacheBy
Atlas Antibodies Anti-CDH4 Antibody
원본

Atlas Antibodies Anti-CDH4 Antibody

상품 한눈에 보기

인간 CDH4 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. RNA-seq 데이터와의 정합 검증을 통해 신뢰성 있는 단백질 발현 분석이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015613-100 Anti-CDH4 Antibody, cadherin 4, type 1, R-cadherin (retinal) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015613-25 Anti-CDH4 Antibody, cadherin 4, type 1, R-cadherin (retinal) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDH4 Antibody

Anti-CDH4 Antibody

Target: cadherin 4, type 1, R-cadherin (retinal)
Supplier: Atlas Antibodies


  • WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human CDH4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cadherin 4, type 1, R-cadherin (retinal)
Target Gene CDH4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YLIDINDNAPELLPKEAQICERPNLNAINITAADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Rat ENSRNOG00000052405 93%
Mouse ENSMUSG00000000305 93%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal
Orthogonal Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.