CacheBy
Atlas Antibodies Anti-CDH19 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDH19 Antibody

상품 한눈에 보기

Human CDH19 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. CDH19 및 관련 카데린 단백질 연구에 유용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056332-100 Anti-CDH19 Antibody, cadherin 19, type 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056332-25 Anti-CDH19 Antibody, cadherin 19, type 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDH19 Antibody

Anti-CDH19 Antibody

Target: cadherin 19, type 2
Product Type: Polyclonal Antibody against Human CDH19


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against human CDH19 (cadherin 19, type 2).
Purified by affinity chromatography using the PrEST antigen as ligand.


Alternative Gene Names

  • CDH7

Target Information

항목 내용
Target Protein cadherin 19, type 2
Target Gene CDH19
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHTEASTTFIKIQV

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID Sequence Identity
Rat ENSRNOG00000029841 74%
Mouse ENSMUSG00000047216 70%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.