CacheBy
Atlas Antibodies Anti-CDH15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDH15 Antibody

상품 한눈에 보기

Human CDH15 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation 수행. PrEST 항원으로 친화 정제된 고품질 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009139-100 Anti-CDH15 Antibody, cadherin 15, type 1, M-cadherin (myotubule) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009139-25 Anti-CDH15 Antibody, cadherin 15, type 1, M-cadherin (myotubule) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDH15 Antibody

Anti-CDH15 Antibody

Target: cadherin 15, type 1, M-cadherin (myotubule)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human CDH15


Alternative Gene Names

CDH14, CDH3

Open Datasheet


Target Information

항목 내용
Target Protein cadherin 15, type 1, M-cadherin (myotubule)
Target Gene CDH15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000027954 (88%), Mouse ENSMUSG00000031962 (87%)

Antigen Sequence:

TFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYRAIVLAQDDASQPRTATGTLSIEILEVNDHAPVLAPPPPGSLCSEPHQGPGLLLGATDEDLPPHGAPFHFQLSPRLPELGRNWSLSQVNVSH

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.