CacheBy
Atlas Antibodies Anti-CDCA5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDCA5 Antibody

상품 한눈에 보기

Human CDCA5 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023691-100 Anti-CDCA5 Antibody, cell division cycle associated 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023691-25 Anti-CDCA5 Antibody, cell division cycle associated 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDCA5 Antibody

Anti-CDCA5 Antibody

Target Information

  • Target Protein: Cell Division Cycle Associated 5
  • Target Gene: CDCA5
  • Verified Species Reactivity: Human
  • Interspecies Identity:
    • Mouse ENSMUSG00000024791 (66%)
    • Rat ENSRNOG00000046635 (64%)
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CDCA5.

Open Datasheet

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    SILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVR

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using PrEST antigen
Preservative Sodium azide (0.02%)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.