CacheBy
Atlas Antibodies Anti-CDC7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDC7 Antibody

상품 한눈에 보기

Human CDC7 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 반응 특이성을 보입니다. 세포주기 관련 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035831-100 Anti-CDC7 Antibody, cell division cycle 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035831-25 Anti-CDC7 Antibody, cell division cycle 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDC7 Antibody

Anti-CDC7 Antibody

Target Information

  • Target Protein: cell division cycle 7
  • Target Gene: CDC7
  • Alternative Gene Names: CDC7L1, HsCdc7, Hsk1, huCdc7

Product Description

Polyclonal antibody against Human CDC7.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000002105 96%
Mouse ENSMUSG00000029283 95%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.