CacheBy
Atlas Antibodies Anti-CDC25A Antibody
원본

Atlas Antibodies Anti-CDC25A Antibody

상품 한눈에 보기

Human CDC25A 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity 정제 방식으로 제조되었습니다. ICC 등 다양한 응용에 적합하며, 40% glycerol 기반 PBS buffer에 보존되어 있습니다. 인체 CDC25A 단백질 검출 연구용으로 권장됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA005855-100 Anti-CDC25A Antibody, cell division cycle 25A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005855-25 Anti-CDC25A Antibody, cell division cycle 25A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDC25A Antibody

Anti-CDC25A Antibody

Target Information

  • Target Protein: Cell division cycle 25A
  • Target Gene: CDC25A
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VAGKHQDLKYISPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPTDGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000020737 (96%)
  • Mouse: ENSMUSG00000032477 (96%)

Product Description

Polyclonal Antibody against Human CDC25A

Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications ICC (Immunocytochemistry)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.