AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CDC14A Antibody
상품 한눈에 보기
Human CDC14A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다. Human에 대한 반응성이 검증되었습니다.
- 카탈로그번호
- HPA023783-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023783-100 Anti-CDC14A Antibody, cell division cycle 14A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023783-25 Anti-CDC14A Antibody, cell division cycle 14A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CDC14A Antibody
Anti-CDC14A Antibody
Target Information
- Target Protein: Cell Division Cycle 14A
- Target Gene: CDC14A
- Alternative Gene Names: cdc14, Cdc14A1, Cdc14A2
Product Description
Polyclonal antibody against Human CDC14A.
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
QQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRAL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000014515 | 82% |
| Mouse | ENSMUSG00000033502 | 81% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.