CacheBy
Atlas Antibodies Anti-CD83 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CD83 Antibody

상품 한눈에 보기

인간 CD83 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제되었습니다. 인간에 특이적으로 반응하며, 정교한 단백질 발현 검증을 지원합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041454-100 Anti-CD83 Antibody, CD83 molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041454-25 Anti-CD83 Antibody, CD83 molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CD83 Antibody

Anti-CD83 Antibody

CD83 Molecule

  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Suitable for ICC and other immunoassay applications.

Product Description

Polyclonal Antibody against Human CD83

Alternative Gene Names

  • BL11
  • HB15

Open Datasheet

Target Information

항목 내용
Target Protein CD83 molecule
Target Gene CD83
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000015396 (64%), Rat ENSRNOG00000018092 (62%)

Antigen Sequence:
PNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEET

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.