CacheBy
Atlas Antibodies Anti-CD80 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CD80 Antibody

상품 한눈에 보기

인간 CD80 단백질을 인식하는 폴리클로날 토끼 항체. IHC 등 다양한 응용에 적합하며 RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050092-100 Anti-CD80 Antibody, CD80 molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050092-25 Anti-CD80 Antibody, CD80 molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CD80 Antibody

Anti-CD80 Antibody

CD80 molecule

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CD80.

Alternative Gene Names

B7-1, B7.1, CD28LG, CD28LG1

Open Datasheet

Target Information

항목 내용
Target Protein CD80 molecule
Target Gene CD80
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000001527 (56%), Mouse ENSMUSG00000075122 (53%)

Antigen Sequence:

YECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENG

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.